SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017944 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017944
Domain Number 1 Region: 15-251
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.96e-79
Family Calponin-homology domain, CH-domain 0.000000455
Further Details:      
 
Domain Number 2 Region: 2839-2963
Classification Level Classification E-value
Superfamily EF-hand 2.1e-49
Family EF-hand modules in multidomain proteins 0.00000599
Further Details:      
 
Domain Number 3 Region: 2965-3060
Classification Level Classification E-value
Superfamily EF-hand 2.27e-38
Family EF-hand modules in multidomain proteins 0.0000149
Further Details:      
 
Domain Number 4 Region: 1920-2076
Classification Level Classification E-value
Superfamily Spectrin repeat 2.38e-28
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 3040-3128
Classification Level Classification E-value
Superfamily RING/U-box 5.65e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 6 Region: 311-418
Classification Level Classification E-value
Superfamily Spectrin repeat 1.16e-19
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 7 Region: 2502-2633
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-19
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 8 Region: 388-526
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-17
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 9 Region: 493-631
Classification Level Classification E-value
Superfamily Spectrin repeat 9.64e-17
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 10 Region: 959-1117
Classification Level Classification E-value
Superfamily Spectrin repeat 1.04e-16
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 11 Region: 2679-2798
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000497
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 12 Region: 2278-2436
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000589
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 13 Region: 1178-1329
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000387
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 14 Region: 1488-1643
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000411
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 15 Region: 743-897
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000439
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 16 Region: 2801-2838
Classification Level Classification E-value
Superfamily WW domain 0.0000000000905
Family WW domain 0.00023
Further Details:      
 
Domain Number 17 Region: 2071-2176
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000838
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 18 Region: 1616-1741
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000907
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017944
Domain Number - Region: 1302-1432
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00468
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number - Region: 2230-2296
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0417
Family Spectrin repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017944   Gene: ENSMPUG00000018055   Transcript: ENSMPUT00000018206
Sequence length 3429
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896934.1:2633344:3135973:1 gene:ENSMPUG00000018055 transcript:ENSMPUT00000018206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKYGEHEARPDDGQNEFSDIIKSRSDEHNDVQKKTFTKWINARFSKSGKPPINDMFTDL
QDGRKLLDLLEGLTGTSLPKERGSTRVHALNNVNRVLQVLHQNNVDLVNIGGTDIVDGNH
KLTLGLLWSIILHWQVKDVMKDVMSDLQQTNSEKILLSWVRQSTRPYSQVNVLNFTTSWT
DGLAFNAVLHRHKPDLFSWDRVVKMSPIERLEHAFSKAQTYLGIEKLLDPEDVAVQLPDK
KSIIMYLTSLFEVLPQQVTLDAIREVETLPRKYKKECEEGEISIQSSALEEEHESPGAET
PSTVTEVDMDLDSYQIALEEVLTWLLSAEDTFQEQDDISDDVEEVKDQFATHEAFMMELT
AHQSSVGSVLQAGNQLITQGTLSDEEEFEIQEQMTLLNARWEALRVDSMDRQSRLHDVLM
ELQKKQLQQLSAWLTLTEERIQKMETCPLDDDLKSLQKLLEDHKRLQNDLEAEQVKVNSL
THMVVIVDENSGESATAVLEDQLQKLGERWTAVCRWTEERWNRLQEINMLWQELLEEQCL
LKAWLTEKEEALNKVQTSNFKDQKELSVSIRRLAILKEDMEMKRQALDQLSEIGQDVGQL
LDNPRASKKINSDSEELTQRWDSLVQRLEDSSNQVTQAVAKLGMSQIPQKDLLETVRVRE
QVTTKRSKQELPPPPPPKKRQTPVDVEAKKKFDAVSAELLNYILKSKTAIQAAEMKGYKK
MQETSEMKKKLKGLEKEQTERSPRLEELNQTGQILLEQMGKEGLPMEEIKTVLEKVFSEW
KDVSQRLEDLARKIQLQEDINTYFKQLDELEKTVKAKEEWLKQTSSQQPMLSLKDPCQRE
LIDLLALHPRIEKVRASCSALKSRPSAPDFVREAFESLLGRYQAVRRELERGQQQLEKEM
KSQPGNAYLETLKTLKDTLNDSESKAQTSLNALNDLTKVEKALQEKKALDEILENQKPTL
YKLAEETKALEKNVSPDVEKMYKQEFDDVQGKWNKLKVKVSKDVHSLEEITSKLRAFEAD
LKVIEKWVDGVKDFLMKEQAVQGDAEELQSQLDQCSAFVNEIETMDSSLKGMREIEANLR
SCPVAGIKTWMQTKLVDYQTQVEKLSKEIAIQKNRLSESQEKAVNLKKDLAEMQEWMTQA
EEEYLERDFEYKSPEELESAVEEMKRAKEDVLQKEVRVKILKDNIMLLAAKAPSGGQELT
SELNVVLENYQLLCNRIRGKCHTLEEVWSCWIELLHYLDLETSWLSTLEERMKSTEAVPE
KADTINEALESLESVLRHPADNRTQIRELGQTLIDGGILDDIISEKLEAFNSRYEELSHL
AESKQIALEKQLQVLRETDHMLQVLQESLGELDKQLTTYLTDRIDAFQVPQEAQKIQAEI
SAHELTLEELKRNTRSQPPTSPEGRNARGGNQMDVLQRKLREVSTKFQLFQKPANFEQRM
LDCKRVLDCVKAELHVLDVKDVDPDVIQSHLDKCMKLYKTLSEVKLEVETVIKTGRHIVQ
KQQTDNPKGMDEQLTSLKILYNDLGAQVTEGKQDLERASQLARKMKKETASLSEWLSVTE
AELVQKSTSGGLSGDLDIEISWAKNILKDLEKRRADLNAITESSAALKNLIEGSEPVLEE
RLCVLNAGWSRVRTWTEDWCSTLMNHQNQLEIFDGNVAHISTWLYQAEALLDEIEKKPAS
KQEEIVKRLISELDDANLQVENVRDQAVVLMNARGGSSRELVEPKLAELNRNFEKVSQHI
KSAKLLIGQEPLSYPCLVTTEAFDADVLFSDLEKLESDIENMLKVVEKHLEFSDEDEKVD
EERAQIEEVLQRGEQMLHQPMEDNKKEKIRLQLLLLRTRYNKTKAAPNHQRRTGQLAPGI
QSPPLPTDYLVEINKVLLSMDDAELSLSAPELSTAAYEDFSFQEDSLKNIKDQLDKLGEQ
IAVIHEKQPDVILEASGPEAIQIRDTLTQLNAKWDRINRMYNDRKGHFDRAMEEWRQFHC
DLNDLTQWITEAEELLAETFAPDGGLDLEKARMHQQELEEGISSHQPSFAALNRTGDEIL
QKLSPTDGSFLRDKLAGLNQRWSAIFAEVKDRRPRLKGESKQVMEYRKRLDDIICWLTKA
ENVLQKRSTTELEENLQELTDLTQEMDVQAEKLKWLNRTELEMLSDKSLSLHEREKISES
LRTINSTWNKICREVPSTLKERIQEPCSVSQTRIAAHPGVQKVVLVSSASDIPVQSPRTS
EISVPADLDKTITELADWLVLIDQMLKSNIVTVGDIEEINKTVSRMKITKADLEQRHPQL
DYVFTLAQNLKNKASSSDVRTAITEKLEKVKNQWDSTQHGVELRQQQLEDMIIDSLQWDD
HREETEELMRKYEARFYILQQARRDPLIKQISDNQVLLQELGPGDGIVMAFENVLQKLLE
DYGNDDTRNVKETTEYLKTSWINLKQSIADRQSALEAELRTVQASRRDLENFLKWIQEAE
TTVNVLADASQRENALQDTVLARELTQQLQDIQAEIDAHNDIFKSIDGNRQKMVKALGNS
EEATMLQHRLDDMNQRWNDLKAKSASIRAHLEASAEKWNRLLTSLEELIKWLNIKDEELQ
KQMPIGGDVPALQLQYDHCKALRRELKEKEYSVLNAIDQARVFLADQPIEAPEEPRRNLQ
SKTELTPEEKAQKIAKAMRKQSSEVKEKWESLNMVTSNWQKQVDKALEKLRDLQGAMDDL
DVDMKEVEAVRNGWKPVGDLLIDSLQDHIEKTMAFREEIAPINLKVKTVNDLSSQLSPLD
LHPSLKISRQLDDLNMRWKLLQVSVDDRLKQLQEAHRDFGPSSQHFLSTSVQLPWQRSIS
HNKVPYYINHQTQTTCWDHPKMTELFQSLADLNNVRFSAYRTAIKIRRLQKALCLDLLEL
NTTNEVFKQHKLNQNDQLLSVPDVINCLTTTYDGLEQMHKDLVNVPLCVDMCLNWLLNVY
DTGRTGKIRVQSLKIGLMSLSKGLLEEKYRYLFKEVAGPTEMCDQRQLGLLLHDAIQIPR
QLGEVAAFGGSNIEPSVRSCFQQNNNKPEISVKEFIDWMRLEPQSMVWLPVLHRVAAAET
AKHQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLHYPMVEYCIPTTSG
EDVRDFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNLETPVTLISMWPEHYDPSQSP
QLFHDDTHSRIEQYATRLAQMERTNGSFLTDSSSTTGSVEDEHALIQQYCQTLGGESPVS
QPQSPAQILKSVEREERGELERIIADLEEEQRNLQVEYEQLKEQHLRRGLPVGSPPDSVV
SPHHTSEDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPESDPRIN
GVSPWASPQQAALSYSLDPDPGPQFHQAAAEDLLAPPQDTGTDLTEFMEQINSTFPSCCP
NLPSRPQAM
Download sequence
Identical sequences M3Z2Y2
XP_004752814.1.14098 XP_004752815.1.14098 ENSMPUP00000017944 ENSMPUP00000017944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]