SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017950 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017950
Domain Number 1 Region: 61-364,619-637
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.62e-34
Family Calpain large subunit, catalytic domain (domain II) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017950
Domain Number - Region: 768-841
Classification Level Classification E-value
Superfamily Globin-like 0.0108
Family Globins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017950   Gene: ENSMPUG00000018061   Transcript: ENSMPUT00000018212
Sequence length 1648
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896934.1:4677597:4850888:1 gene:ENSMPUG00000018061 transcript:ENSMPUT00000018212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKQTKKKEVHRINSAHGSDKSKDQYYLGSSAQPSSVEQKKGKFPIWPEWSEADVNAEK
WDAGKGGKEKDKAGKSPLFHFFEDPEGKIELPPSLKIYSWKRPQDFLIHRAPVVVRNEIL
FDLFSANEHLLCSELMRWIISEIYAVWKIFNGATLNNYFKGNAGEPPPLIWKPWEHIYSL
CKAVKGHMPLFNNYGKYIVKLYWMGCWRKITIDDILPFDEDNNLLLPATTCEFELWPMLL
CKAIIKLANVDIHIAERRELGEFTVIHALTGWLPEVISLHPGYMDKVWELLKEILPEFKL
SDESSSESKIAMLDAKLKEPVKDSKEFKPEGSMTALKVPEKSDKTPKEKADAKDVGKKKS
KNGEKEKEKEKFKWSLHASRPSSDVQYSLQSLSDCSSAIQSPHMVVYATFTPLYLFEKKI
FSLEKMAGSAEKLREYGLSHICSHPVLVTRTRSCPLIAPPKSPPVPAWKLFRQKKETVIT
DEAQELITKKPEQFLEISSPFLNYRMTPFTIPTETHFVQSFIKKGVPPRFDLSSITENDE
TATISQPDLSQLTGAVSQGNVISQAILGKDELIDLGLNDATHQGEGLSLERDLVSLTTAT
QDKSQEELATINNNVSKEIWLDFEDFCVCFQNIYIFHKPNSYCLSFQKTEFKFSDERVPY
YLFVDSLKPIELLVCFSALVRWGESGALAKDSPQIEPGLLTAESVSWKSLKSRELVTKIH
TYATKATVVRLPVGRHMLLFTAYSPVGHSIHICSMVTFVVGDEDVVLPHFEPESYRFTEQ
SLTILKAVGHVIASFKDKGKLSVAMKDLQAAHYPIPLHNKELTTQHFRVFHISLWRLMKK
TQLTKPPPNFKFAFRAMVLDLELLDFSLEEVSLAEWVDVKYSLPVSDKEYSPEEVAAAIK
IQAMWRGSYVRLLMKARTPDTKENASVADTLQKVWSILEPNIEQYAVSLLRLMFKSKCKS
IESYPCYQDEETKIVFADYTVAYADQLPNSWFIVFRETFLVPQDMILVPKVYTTLPVCML
HIVNNDTMEQVPKVFQRVVPYHYTKNKKGYTFVAEAFTGDTYVPSSRWKLRIIGSCNPLP
CLSRESPCNTFTIKEIRDYYIPNDKKILFRYSIKVALPHPVTVQVRTSKPDVFIKLQILE
NEEIVVSSTGKGHAIIPAINFLGSEKVVSSQSSKQVLLMHSASKKEQELYSKKKSTQGSQ
KSYKGRPASAIVDPGQPILEEEVVSMPTIEENASTAQQVNKYIIQCLVLYNSWPLTESQQ
TFVQALKELEKSDSKAHGEKHEELVTLGSPDSHTISEGQKSSGTSKTRKGKEKSSEKDKT
AREKQAPRFEPQISTVHPQQEDPNKPYWILRLVTEHNEAEFFEVKKDTERADEIRAMKQA
WEMTEPGRAIKASQARLHYLSRFIKKIPDADSMPVSESQTKALEEVETLSSATRESDTKS
SVSSDNKDVIPSGNMLWKKWQMGKGLKDLSKSGSSESGGTSPAGKEEQSMRKEIRSRSRS
PTILEMSPRLIRKALECVNLNQYVRKTMDYDPMLQTEESNQHQAMQKAEEVHQFRQYRTR
VLSVRDIDQEEQLKIKDKILEMYGEMRDSLDEARQKIFDIREEYRNKLLEAERLRLEALA
VEEATSPVEPEKKTLSPDTQKKKKGKKK
Download sequence
Identical sequences M3Z2Y8
XP_012911705.1.14098 ENSMPUP00000017950 ENSMPUP00000017950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]