SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017958 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017958
Domain Number 1 Region: 16-134
Classification Level Classification E-value
Superfamily PH domain-like 2.4e-52
Family Dcp1 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017958   Gene: ENSMPUG00000018069   Transcript: ENSMPUT00000018220
Sequence length 613
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897084.1:1967088:2022169:-1 gene:ENSMPUG00000018069 transcript:ENSMPUT00000018220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAAGGLVGKGRDISLAALQRHDPYINRIVDVASQVALYTFGHRANEWEKTDVEGTLF
VYTRSASPKHGFIIMNRLSMENRTEPITKDLDFQLQDPFLLYRNARLSIYGIWFYDKEEC
QRIAELMKNLTQYEQLKAHQGGGTGNSPMILNSGEGKEVDILRMLTKAKDEYTKCKTCSE
PKQITSSSAIYDNPNLIKPIPVKPSENQQQRIPRPSQTLDPEPQHLSLTALFGKQDKSTC
QETVGSPPTIHQQQQQQEPLPVRQGVVRSLSYEEPRRHSPTIEKQLCPAIQKLMVRSADL
HPLSELPENRPCRNGNTRSAGEVFLGPVQPGSTHSVGTSQRVQSASGTQSLLEKLQSGPR
PATKFEPSTAAPASSAVPNLSTTLPAATPGAPIKGQAQAQAEYFNGSLPAQPLGHQVHGK
EPSTHPRPMLPHSGNQTSSSGVISPQELLKKLQTVQQEQQLHTSNRPALAAKFPVVAQGS
RTRKALESWMDKTAGTEKQTPLFQATSPPRVPATRAPSLLMSPMVFTQPTCAPPKERDAG
LLPLGSQETAAASTNLLLPLPAPEPPVVTSSPLTKLQLQEALLYLVQNDDNFLNIIYEAY
LFSMTQAAMKKTM
Download sequence
Identical sequences M3Z2Z6
ENSMPUP00000017958 ENSMPUP00000017958 XP_004773807.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]