SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018003 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018003
Domain Number 1 Region: 389-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-37
Family Calponin-homology domain, CH-domain 0.0000884
Further Details:      
 
Domain Number 2 Region: 87-241,386-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.01e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.072
Further Details:      
 
Domain Number 3 Region: 784-817
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000214
Family LIM domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000018003
Domain Number - Region: 818-846
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000689
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018003   Gene: ENSMPUG00000018115   Transcript: ENSMPUT00000018266
Sequence length 1938
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897084.1:3306282:3578329:-1 gene:ENSMPUG00000018115 transcript:ENSMPUT00000018266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSKNETMNRAHILFDRFVQATTCKGTLKAFQELCDHLELKPKDYRSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKACTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLVQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYKDDTHYFV
MTAKKQSLLDKGVILHDYADTELLLSRENVDQEALLNYAREAADFSTQQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGTSPLEVLAERESIYRLLPQTTPENVSKNFSQYSIDPVTRYPNINVNFLR
PSQVRHLYDTGETKDIHLEMENLVNSRTTPKLTRNESVARSSKLLGWCQRQTDGYAGVNV
TDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKE
MASVGEPDKLSMVMYLTQFYEMFKDSLPSSDALDLNAEDKAVLIASTKSPISFLSKLGQT
ISRKRSPKDKKEKDLDGAGKRRKTSQSEEEDVPRGYRGGRPTLVSTLTDRRMDVALGNQN
KVKYMATQLLAKFEENAPPQSTGMRRQPTQERGVSQPSCCLPEQGHPAPTPQWKQGSIKK
EFPQNLGGSDTCYFCRKRVYVMERLSAEGKFFHRSCFKCEYCATTLRLSAYAYDIEDGKF
YCKPHYCYRLSGSAQRKRPAVAPLSGKEAREALQDGPTVDTSGRASTIASPAERTPGSSV
NGLEEPSIAKRLRGTPERIELENYRLSVKQAVELEEVPEETQAEHNLSSALDKGAEEDVA
SSSSESEMEEEEEEEEPPLPPSDLGGVPWKEAVRIHALLKGKSEKELEASKSYGPGNEEE
EEEEEYEEEEEEEEEYEEEEEESSEVGSQRLQQIINPADPLEIQADVHWTHIREKEEEER
MVPTSESSTSRVPFDENDLEEDVDSEPAEIEGEAAENGDTGDTGAELDDDQHWSDEIPSD
AETELRMQHRAALEAELELRVSENEDEQPAPTPGYQERSPAQVPSPAPSPEEQAGLLSPG
HSPVAEGAQIPPVSVATKVKLPEDSLFPEPLLPKVKPKAELPTDQRAMRSPIRLQPVALP
EARTPTSPVSTQRLSPLATSTPTTTQLPICSQPQPSSEATVPSPTKSPICFQPVPAKTAI
PVASLPLKNQGDTKDRLGCPLAVDEALKRNDLVAEFWMKSAEIRRSLGLTPIDRSKVSES
SFPSPTFKPVSLKSYSVEKSPQSEGLQLLKLPPVPKRLGLPKPDGDQPSLPTPKSPSDRE
LKSSHEEKRDPSSSSGLGLHGSSSNMKTLGSQSFNTSDSTMLTPPSSPPPPPPQDEEPAT
LRRKLYQTYEHKETKPKASVIPPSPPASFMRTPREPAQPPREEVRKSFVESVDEIPFADD
VEDTYDDKTEDSSLQEKFFTPPSCWPRTERPLNPPLAKENGRLPTLESGIQPQKRGLPVV
SPEAKELAEERMRAREKSVKSQALRDAMAKQLSRMKEMEMAAGTSRPPGGTSRKASSVPS
KGKDLRPESPKRPVLKGPREPTLKHEATCEEVLSPPSDSGGPDGSVTSSEGSSGKSKKRS
SLFSPRRNKKEKKSKGEGRPPEKPSPNLLEEATAKPKSLWKSVFSGYKKDKKKKGDDKSC
SSTPSSGATVDSGKHRMSPIVKAELQLRRQLSFSEDSDLSSDDILERSSQKSRREPRTYT
EEELNAKLTRRVQKAARRQAKQEELKRLHRAQIIQRQLEQVEEKQRQLEERGVAVEKALR
GEAGRGRERSRLPAEQGA
Download sequence
Identical sequences M3Z341
ENSMPUP00000018003 ENSMPUP00000018003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]