SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018014 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018014
Domain Number 1 Region: 349-563
Classification Level Classification E-value
Superfamily ADP-ribosylation 6.19e-77
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.00000000322
Further Details:      
 
Domain Number 2 Region: 215-348
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 6.02e-47
Family Domain of poly(ADP-ribose) polymerase 0.000000394
Further Details:      
 
Domain Number 3 Region: 66-191
Classification Level Classification E-value
Superfamily WGR domain-like 2.62e-43
Family WGR domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018014   Gene: ENSMPUG00000018126   Transcript: ENSMPUT00000018277
Sequence length 567
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897292.1:497388:506786:-1 gene:ENSMPUG00000018126 transcript:ENSMPUT00000018277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARRRGTRSNGVGALDEAGRVHNGNTAVEDPLPAKKTRRCQRQGVKKEPVNGGEANNNK
TEDKQESVKTLLLKGKAPVDPECTAKVGKAHVYCEGNDVYDVMLNQTNLQFNNNKYYLIQ
LLEDDAQRHFSVWMRWGRVGKMGQHSLVACSGDLNKAKEIFQKKFLDKTKNNWEDREKFE
KVPGKYDMLEMDYTTNTQSEEESKGDSLKSPLKPESQLDLRVQELIELICNVQAMEETMV
EMKYDTKKAPLGKLTVAQIKAGYRSLKKIEDCIRAGQHGRALMEACNEFYTRIPHDFGLR
TPPLIRTEKELSDKVQLLEALGDIEIAIKLVKTELQSPEHPLDQHYRKLHCALHPLDHES
YEFKVISQYLQSTHAPTHRDYTMTLLDVFEVEKEGEKEAFREDLHNRMLLWHGSRLSNWV
GILSHGLRIAPPEAPITGYMFGKGIYFADMSSKSANYCFASRVKDTGLLLLSEVALGQCN
ELLEANPEAERLLQGKHSTKGLGKMAPSPASFITLNGSMVPLGPASDTGVLNPDGYTLNY
NEFIVYNPNQVRMRYLLKVRFNFLQLW
Download sequence
Identical sequences M3Z352
XP_004781522.2.14098 ENSMPUP00000018014 ENSMPUP00000018014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]