SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018017 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018017
Domain Number 1 Region: 16-221
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.07e-61
Family BAR domain 0.00000833
Further Details:      
 
Domain Number 2 Region: 598-675
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000016
Family SH3-domain 0.000075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018017   Gene: ENSMPUG00000018129   Transcript: ENSMPUT00000018280
Sequence length 676
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896901.1:41016:269331:-1 gene:ENSMPUG00000018129 transcript:ENSMPUT00000018280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNILPYWANRTSQVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQRELRGYLAAIKGM
QEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLTLDTYLGQFPD
IKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVFEEFNVDLQEE
LPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHADKAFTIQGAPS
DSGPLRIAKTPSPPEEASPIPSPTASPNHTLAPASPAPARPRSPSQTRKGPPVPPLPKVT
PTKELQQENIISFFEDNFVPEISVTTPSQNEVPEVKKEETLLDLDFDPFKPEVAPPGSAG
VTHSPMSQTLPWDLWTTSTDLVQPASGSTFNGFTQPQDTSLFTMQTDQSMICNLAESEQA
PPTEPKAEEPPVVAAPAVGLDSGLDTQAEEPVEGAVVIPGTDATVTPGAVVLAAEEAPVE
ETEMEKAALPAGEGAGVEETRTDADTMEAIDRDISQPEEPEAAAPQEKVIPSVVIEPASN
NEGEGDHEVPTGAESMETPGAPALPGPASEPPELAAEPRASEDSQPLPSTPAASEASQDV
PPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKESDWLQYRDL
ATYKGLFPENFTRRLD
Download sequence
Identical sequences M3Z355
ENSMPUP00000018017 XP_004739401.1.14098 ENSMPUP00000018017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]