SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018036 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018036
Domain Number 1 Region: 1233-1593
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.22e-122
Family Hect, E3 ligase catalytic domain 0.00000000983
Further Details:      
 
Domain Number 2 Region: 818-854
Classification Level Classification E-value
Superfamily WW domain 0.00000000000475
Family WW domain 0.0014
Further Details:      
 
Domain Number 3 Region: 213-311
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000637
Family Synaptotagmin-like (S variant) 0.065
Further Details:      
 
Domain Number 4 Region: 1003-1045
Classification Level Classification E-value
Superfamily WW domain 0.000000000145
Family WW domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018036   Gene: ENSMPUG00000018147   Transcript: ENSMPUT00000018299
Sequence length 1599
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896901.1:4507195:4957402:1 gene:ENSMPUG00000018147 transcript:ENSMPUT00000018299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLHLCSVKNLYQNRFLGLAAMASPSRTSQNRRRCKEPLRHSYNPGQFHSMAIRNGPHGT
VTIPRSTSDTDLVTSDSRSTLMVSSSYYSIGHSQDLVIHWDIKEEVDAGDWIGMYLIDEV
LSENFLDYKNRGVNGSHRGQIIWKIDASSYFVEPETKICFKYYHGVSGALRATTPSVTVK
NSAAPIFKSIGSDETVQGQGSRRLISFSLSDFQAMGLKKGMFFNPDPYLKISIQPGKHSI
FPALPHHGQERRSKIIGNTVNPIWQAEQFSFVSLPTDVLEIEVKDKFAKSRPIIKRFLGK
LSMPVQRLLERHAIGDRVVSYTLGRRLPTDHVSGQLQFRFEITSSIHPDDEEISLSADPE
SAETQDSPMNSLVASSRGEPAGEALEPSGSSEPEPSSQDGAGDAAGSESLEPAEPVEEAA
GTTEAGDDGAGSVGPDGAGELLGPGREDAEPALSAEELAQRLELGGEAPPPGLLEDGEAR
GSPREPEAEEAAAESRAGGEEKEQAEEEEEEGDLSALGQGEDRLPLRASVKRKSRPCSLP
VSELETVIASACGDPETPRTHYIRIHTLLHSMPSAQGGDDGPEEEATLQDASEKDGLSEV
DTLAAAPPPLGEDGEGPEGATPDTATPGHSGLTNGVVPDGDLLPSTGSESDSSPRQGGDH
SCEGCDTSCCSPSCYSSSCYSTSCYSSSCYSASCYSPSCYNGSRFASHTRFSSVDSAKIS
ESTVFSSQDDDEEENSAFESVPDSVQSPELDPESANGAGPWHDELVTPTGSVARTVEGLE
SPVAGPSNRREGECPILHNSQPVSQLPSLRPEHHHYPTIDEPLPPNWEARIDSHGRVFYV
DHVNRTTTWQRPTAAATPDGMRRSGSIQQMEQLNRRYQNIQRTIATERSEEDSGSQSCEQ
VPAGGNGGGGGSDSEAESSQSSLDLRREGSLSPVNSQKITLLLQSPAVKFITNPEFFTVL
HANYGAYRVFTSSTCLKHMILKVRRDARNFERYQHNRDLVNFINMFADTRLELPRGWEIK
TDQQGKSFFVDHNSRATTFIDPRIPLQNGRLPNHLTHRQHLQRLRSYSAGEASEVSRNRG
ASLLARPGHSLVAAIRSQHQHESLPLAYNDKIVAFLRQPNIFEMLQERQPSLARNHALRE
KIHYIRTEGNHGLEKLSCDADLVILLSLFEEEIMSYVPLQAAFLPGYSFSPRCSPCSSPQ
NSPGLQRASARAPSPYRRDFEAKLRNFYRKLEAKGFGQGPGKIKLIIRRDHLLEGTFNQV
MAYSRKELQRNKLYVTFVGEEGLDYSGPSREFFFLLSQELFNPYYGLFEYSANDTYTVQI
SPMSAFVENHLEWFRFSGRILGLALIHQYLLDAFFTRPFYKALLRLPCDLSDLEYLDEEF
HQSLQWMKDNNITDILDLTFTVNEEVFGQVTERELKSGGANTQVTEKNKKEYIERMVKWR
VERGVVQQTEALVRGFCEVVDSRLVSVFDARELELVIAGTAEIDLNDWRNNTEYRGGYHD
GHLVIRWFWAAVERFNNEQRLRLLQFVTGTSSVPYEGFAALRGSNGLRRFCIEKWGKITS
LPRAHTCFNRLDLPPYPSYSMLYEKLLTAVEETSTFGLE
Download sequence
Identical sequences M3Z374
ENSMPUP00000018036 XP_004739423.1.14098 XP_004739424.1.14098 ENSMPUP00000018036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]