SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018071 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000018071
Domain Number - Region: 96-116
Classification Level Classification E-value
Superfamily WW domain 0.0544
Family WW domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018071   Gene: ENSMPUG00000018183   Transcript: ENSMPUT00000018335
Sequence length 149
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896901.1:13405305:13419237:-1 gene:ENSMPUG00000018183 transcript:ENSMPUT00000018335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMRERRRPQFRLLLLLLLCGGCPPAGGCNETRMLEKLPLCGKAFADMMRTLDAWKRCNL
SEFIVYYESFTNCTEVETNVVGCYWPNPLAQGFISGVHRQFFANCTVDRTHWEDPPDEVL
IPLIAVPVLLTVAMAGLVVWRSKRPDQLL
Download sequence
Identical sequences M3Z3A9
ENSMPUP00000018071 XP_004739492.1.14098 ENSMPUP00000018071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]