SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018075 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000018075
Domain Number - Region: 91-247
Classification Level Classification E-value
Superfamily PH domain-like 0.000307
Family Phosphotyrosine-binding domain (PTB) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018075   Gene: ENSMPUG00000018187   Transcript: ENSMPUT00000018339
Sequence length 426
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896901.1:13477174:13523860:-1 gene:ENSMPUG00000018187 transcript:ENSMPUT00000018339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCRCPPRTSRSQAAKPFPAAPPPSGPVGSALRCRPGIVSPFKRVFLKGEKSRDKKAHEKV
TERRPLHTVALSLPERVEPDRLLSDYIEKEVKYLGQLTSIPGYLNPSSRTEILHFIDNAK
RAHQLPGHLTQEHDAVISLSAYNVKLAWRDGEDTILRVPIHDIAAVSYVRDDASHLVVLK
TAQDPGISPSQSLCAESSRGLTTVSLSESGVGPVEACCLVILATESKVAAEELCSLLGQV
FQIVYTESTIDFLDRAIFDGASTPTHHLSLHSDDSSTKVDVKEPYETDVSAFSFPECAHV
GGVSPLSFCMQTAPHAKTASESELSATAAELLQDYMLTLRTKLSSQEIQQFAALLHDYRD
GASVHEFCINLRQLYGDSRKFLLLGLRPFIPEKDSQHFENFLETIGVKDGRGIITDSFGR
YRRALS
Download sequence
Identical sequences M3Z3B3
ENSMPUP00000018075 ENSMPUP00000018075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]