SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018101 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018101
Domain Number 1 Region: 39-117
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000942
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0034
Further Details:      
 
Domain Number 2 Region: 134-253
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000266
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000018101
Domain Number - Region: 287-434
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000504
Family WD40-repeat 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018101   Gene: ENSMPUG00000018213   Transcript: ENSMPUT00000018365
Sequence length 610
Comment pep:novel scaffold:MusPutFur1.0:GL896901.1:14343039:14415783:1 gene:ENSMPUG00000018213 transcript:ENSMPUT00000018365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEQNLEIKFYISSGPASLSSHSGDEANPVKVVDSAHLPVHTPTIKRKEYHSSIHLPTKS
KSHRFFLTSFTAPTKCHQCTSLMVGLIRQGCACDACGFSCHTTCVEKAPRACPVPSQQKK
GALCLDAQAGMGTAYEGRVWIPKKAGARKGWQRALAVVCDFKLFLYNMDEEKDSKPNVVV
SQVIDMRDGAFSVSSVWLSNFIPVRRKEMPCVFTVTASQLSAPRNRYSVPILADSENEKW
EWVRVLRDLHKTLRKSPSRDRSVYVLEEAYDGSLPLIRTSRTAAIIDNKRIALGNEEGFF
VVHVTIGEIIRVGNMKKIHQIELIPHGQMVAVISGRSHHVRLFPMSALDGRKTDTHKLAE
TKGCQTMTSGTVCQGAHTCLCVARKSQVFCYELFQSKKISHRKFKELQIPTSVQWMAIFN
EQLCVGFQSGFLRCPLRKEGVPYRMLHSQDPTLSFIAHEPMDALCAVEISSIEYLLCFKS
IGIYTDSRGLRSRPVELMWPAAPTYCRYNAPYLSVYSENAVDIFNVNSMEWIQTVPLKKV
RPLNSEGSLNILLLETKRLIYFKKKMTYGEEMVFPQTSDNHQKQMVRHLHSKQRYSFRVP
RRKGHLPMGL
Download sequence
Identical sequences M3Z3D9
ENSMPUP00000018101 ENSMPUP00000018101 XP_012915353.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]