SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018131 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018131
Domain Number 1 Region: 537-570,651-725
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.75e-16
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018131   Gene: ENSMPUG00000018245   Transcript: ENSMPUT00000018397
Sequence length 780
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896901.1:16985108:17034678:-1 gene:ENSMPUG00000018245 transcript:ENSMPUT00000018397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPGSRLEPPPLPEYSCSYVVSRPVYSELAFQQQYERRLQERKTLRESLAKGCSCSRKR
GLGVLKTLLPVLDWLPKYRIKEWLLSDIISGVSTGLVGTLQGMAYALLAAVPVGYGLYSA
FFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLSMAPDEHFRVSSSNGTAFNTTVIDYVA
RDTARVLIASTLTLLVGIIQLIFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVL
NVSTKNYNGVLSIIYTLIEIFQNVGNTNLADFIAGLLTIIICMAVKEVNDRFKHKIPVPI
PIEVIVTIIATAISYGADLEKNYNAGIVKSIPRGFLPPILPPVSLFSEMLAASFSIAVVA
YAIAVSVGKVYAIKYDYTIDGNQEFIAFGISNIFSGFFSCFVATTALSRTAVQESTGGKT
QIAGIISAGIVMIAIVALGKLLEPLQKSVLAAVVIANLKGMFMQVCDIPRLWRQNKIDAV
IWVFTCIASIILGLDLGLLAGLMFGLLTVVLRVQFPSWNGLGSVPSTDIYKSTKSYKNIE
ELEGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKKGQLRAT
KNGIIRDAGSSNNAFEPDEDIEDPEDLDIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVL
DCGAVSFLDVVGVRSLRMIVKEFHRIDVNVYFASLQDHVIEKLEKCGFFNDNIRKDIFFL
TVHDAVLHLQNQVKSREVQDSILETITLMQDCKDPLELMEAELIEEELDVQDEAMRSLAS
Download sequence
Identical sequences M3Z3G9
XP_004739586.1.14098 XP_004739587.1.14098 ENSMPUP00000018131 ENSMPUP00000018131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]