SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018137 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018137
Domain Number 1 Region: 728-1089
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.02e-103
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.00000000000292
Further Details:      
 
Domain Number 2 Region: 526-725
Classification Level Classification E-value
Superfamily ARM repeat 7.48e-62
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00000000358
Further Details:      
 
Domain Number 3 Region: 351-524
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.42e-55
Family PLC-like (P variant) 0.0000000375
Further Details:      
 
Domain Number 4 Region: 144-321
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.38e-51
Family Ras-binding domain, RBD 0.0000000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018137   Gene: ENSMPUG00000018251   Transcript: ENSMPUT00000018403
Sequence length 1102
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896901.1:17650144:17680306:-1 gene:ENSMPUG00000018251 transcript:ENSMPUT00000018403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELENYEQPVVLREDNRRRRRRMKPRNSAASLSSMELIPIEFVLPTSQRNSKTPETALLH
VAGHGNVEQMKAQVWLRALETSVAADFYHRLGPDHFLLLYQKKGQWYEIYDKHQVVQTLD
CLRYWQVLHRSPGQIHVVQRRAPSEETLAFQRQLTALIGYDVTDVSNVHDNELEFTRRRL
VTPRMVEVAGRDPKLYAMHPWVTSKPLPEYLLKKITNNCIFIVIHRSTTSQTIKVSADDT
PGTILQSFFAKMAKKKSLMDIPESQNEQDFVLRVCGRDEYLVGETPIRNFQWVRHCLKNG
EEIHLVLDSPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNADLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKI
KDLPRGALLNLQIYCSKTPVLSGKVAAESPSSESKGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQISGKGEDHGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHRPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDFTQQVHVIETLQKVTIDIKSLSAEKYDVSSQVISQLKQKLENLQNANLP
KSFRVPYDPGLKAGALVIEKCKVMASKKKPLWLEFKCADPTALSSETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQKFQDVCVKAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEEAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
Download sequence
Identical sequences M3Z3H5
ENSMPUP00000018137 ENSMPUP00000018137 XP_012915678.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]