SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018189 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018189
Domain Number 1 Region: 12-390
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 4.95e-126
Family Choline/Carnitine O-acyltransferase 0.00000000000507
Further Details:      
 
Domain Number 2 Region: 393-593
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.5e-68
Family Choline/Carnitine O-acyltransferase 0.0000000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018189   Gene: ENSMPUG00000018307   Transcript: ENSMPUT00000018459
Sequence length 614
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896901.1:30949813:31040017:1 gene:ENSMPUG00000018307 transcript:ENSMPUT00000018459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLEAVKPFANKEEYKKTKEIVQKFQD
GIGRKLHQKLLERAKGKRNWLEEWWLNCAYLDVRLPSQLNVNFAGPAPYIEHYWPPKEGT
QLERGSINLWHNLNYWQLLRKEKVPVDKSENSPLDMNQFRMLFSTCRIPGITRDSVISYF
RTESEGHSPTHIAVLCRGRVFVFDIIHEGCLITPPEIYRQLTYIHRKCHSEPDGPGIAAL
TSEERTQWAKAREYLISLDPENLTMLEKIQSSLLVYSIEDSSPHVTPEDYSQVTTMTLTG
DPTVRWGDKSYNLISFSNGVFGCSCDHAPFDGMVMVNISHYINEKVFENEGRWKGSEKVR
DISLPEELVFTVDDKILNDINQAKAQFLKQASDLQIVVYPFTSFGKNLTKKKLLHPDTFI
QLALQLAYYRLYGRPGSCYETATTRCFYHGRTETMRSCTIEALRWCQSMQDPSTGLLERQ
QKMLQAFAKHNKMMKDFSAGKGFDRHLLGLLLIAKEEGLPVPELFTDPLFSKSGGGGNFV
LSTSLIGYFKVQGVAVPMVHNGYGFFYHIRDDRFVVACSSWEASALKNDCERFRDSRAGH
VSSTSLKCVADLCA
Download sequence
Identical sequences M3Z3M7
ENSMPUP00000018189 ENSMPUP00000018189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]