SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018192 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000018192
Domain Number - Region: 50-102,167-191
Classification Level Classification E-value
Superfamily BRCT domain 0.000621
Family DNA ligase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018192   Gene: ENSMPUG00000018310   Transcript: ENSMPUT00000018462
Sequence length 683
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896901.1:31263881:31468202:1 gene:ENSMPUG00000018310 transcript:ENSMPUT00000018462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLLTYPLSLEMNFCSPIYACFQGGIQVKNEKNRSVKSMKTDNKPEKSKYKPLWGKIFY
IDLPSITISEKLQKDIQDLGGRVEEFLSKDISYLISNKKEAKFAQTLGRISPVPSPESAY
TAETTSPHPSHDGSSFKSPDSVCLSRGKLLVEKAIKDHDFIPSNSILSNALSWGVKILHI
DDIRYYIEQKKKELYLLKKSSTSVRDVGKRVGTGTQKARTGRLKKPFVKVEDTSQLYRPF
YLQLNNMPFINYSIQKPSSPFDVDKPSSIQKQTQVKLRIQTDGNKRGGIPIQLQLKEKKK
KGYCECCLQKYEDLESHLLSEQHRNFAQSNHYQVVDDIVSKLIFDFVEYERDMPKKKRIK
YSIGSLSPITTSVLKKSEPKELQRISQKDFKENNVQVIEQHFLYKEIQEPEQKFLFISEC
IPHSSSELRGLNEKVTTKCSMLNTGENDIKQNFAHLPPHKNKPECILDVSEHKLMTNESD
LEELRVDHCPCRLKTSVQVSNFSMDSTASQPKQKSDTVLFPAKDLKEKDLHPIFSHDSGL
LAVNSSQEHLTIKAKTPSRSPPEEPNECDFNNMDGLPSGTIHRKVKILLGRNKKENLEPN
VELDKKRPEYLITQEGNRICSTPVQSLLDLFQTSEEKSEFLGFTSYTENSSICDVLDIWE
EENSSNLLSMFFSSPSTSTFTGF
Download sequence
Identical sequences M3Z3N0
ENSMPUP00000018192 ENSMPUP00000018192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]