SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018424 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018424
Domain Number 1 Region: 39-102
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.09e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018424   Gene: ENSMPUG00000018542   Transcript: ENSMPUT00000018694
Sequence length 152
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897156.1:1740803:1741261:-1 gene:ENSMPUG00000018542 transcript:ENSMPUT00000018694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSCKPTNPAAGTRAAPACAGGAECAGACAGAGRLESAARRRLAANARERRRMQGLNTAF
DRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVSLHCEHFGRDH
YLPFASAKLPGEGEPYGQRLFGFQPEPFQMAS
Download sequence
Identical sequences M3Z4B2
ENSMPUP00000018424 ENSMPUP00000018424 XP_004777888.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]