SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018522 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018522
Domain Number 1 Region: 10-284
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 9.64e-30
Family Reverse transcriptase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018522   Gene: ENSMPUG00000018641   Transcript: ENSMPUT00000018793
Sequence length 300
Comment pep:novel scaffold:MusPutFur1.0:GL897041.1:18110:19349:1 gene:ENSMPUG00000018641 transcript:ENSMPUT00000018793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNERGEITTNTKEIQTIIRTYYEQLYGNKFDNLEEMDAFLETYKLPQLNQEEIESLNRPI
TSKEIETVIKNLQTNKSPGPDGFPGEFYQTFKEELIPILLKLFQKIEMEGKLPNSFYEAS
ITLIPKPDKDPTKKESYRPISLMNTDVKILNKILANRIQQYIKRIIHHDQVGFIPGLQGW
FNIHKSVNVIQHINKRKNKNHMILSIDAEKAFDKVQHPFLIKTLQSVGIEGTYLNIIKAI
YEKPTANIILNGEKLKAFPLRSGTWQGCPLSPLLFNIVLEVLPSAIRQQKEIKGIQISKE
Download sequence
Identical sequences M3Z4L0
ENSMPUP00000018522 ENSMPUP00000018522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]