SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018612 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018612
Domain Number 1 Region: 22-167
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-55
Family Ran-binding domain 0.000000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018612   Gene: ENSMPUG00000018732   Transcript: ENSMPUT00000018884
Sequence length 208
Comment pep:novel scaffold:MusPutFur1.0:GL897258.1:68711:69337:1 gene:ENSMPUG00000018732 transcript:ENSMPUT00000018884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAKDTHEDHDTSTENADESNHDPQFEPIASLPEQEIKTLEDDEEELFKMRAKLFRFAS
ENNLPEWKEQGTGDVKLLKHTEKGTIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW
VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIEEREKKGSGKNNDAEKVT
EKLEALSVKEESKESEDTESKAAAEEEQ
Download sequence
Identical sequences M3Z4V0
ENSMPUP00000018612 ENSMPUP00000018612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]