SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018668 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018668
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.31e-52
Family Cofilin-like 0.0000000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018668   Gene: ENSMPUG00000018788   Transcript: ENSMPUT00000018940
Sequence length 165
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896933.1:9496509:9497006:1 gene:ENSMPUG00000018788 transcript:ENSMPUT00000018940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDV
GVTITDPFKHFVGMLPEKDCCYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASS
KDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV
Download sequence
Identical sequences M3Z506
ENSMPUP00000018668 ENSMPUP00000018668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]