SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018773 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018773
Domain Number 1 Region: 56-206
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-25
Family Phosphotyrosine-binding domain (PTB) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018773   Gene: ENSMPUG00000018893   Transcript: ENSMPUT00000019045
Sequence length 427
Comment pep:known scaffold:MusPutFur1.0:GL896912.1:12576943:12578226:1 gene:ENSMPUG00000018893 transcript:ENSMPUT00000019045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPWKKHKFELLAEAPPRQASKPKGYAVSLHYSALSSLARACPEGALSRVGSMFRSKRKK
LHITSEDPTYTVLYLGNATTIQARGDGCTDLAVGKIWSKSEAGRQGTKMKLTVSAQGIRM
VHAEERALRRPGHLYLLHRVTYCVADARLPKVFAWVYRHELKHKAVMLRCHAVLVSKPEK
AQAMALLLYQTSANALAEFKRLKRRDDARHQQQELVGAHTIPLVPLRKLLLHGPCCYKPP
VERSRSAPKLGSITEDLLGEQQEQELQEEEEEERTESCLEEEEEEVDRAEEGDAAAEEAE
AQRALVVAMHLECGDLLDTLESGREEALGGGGVSLSPGAGPPPLLLGSASDMKAELSQLI
NDLGELSFGNDVRSLQADLRVTRLLSGESTGSESSIEGGGPDATSPATAADRSGPNDGAN
PEEPHSG
Download sequence
Identical sequences M3Z5B1
XP_004745352.1.14098 ENSMPUP00000018773 ENSMPUP00000018773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]