SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018833 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018833
Domain Number 1 Region: 91-184
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000172
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.048
Further Details:      
 
Domain Number 2 Region: 391-482,556-714
Classification Level Classification E-value
Superfamily ARM repeat 0.000000322
Family PBS lyase HEAT-like repeat 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018833   Gene: ENSMPUG00000018953   Transcript: ENSMPUT00000019105
Sequence length 865
Comment pep:novel scaffold:MusPutFur1.0:GL896981.1:8061135:8064412:1 gene:ENSMPUG00000018953 transcript:ENSMPUT00000019105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGKPKMEVRGSGTRGNSADLRNHQRPPERYFSAIFHRNFPLPPPEQWSLPQQRQLQST
PGTCDPAAPHTETNTGDGKPAVAIADTRYLVKVYSLNEDQQWDDLGTGHVSSTYVKRLQG
VSLLVRSDSQAALILESKINSNTPYQKQQETLIIWSEGENHGVALSFQDTEGCHKIWEEI
CHIQGKDPSIKITQDLLEESKEEQLHDVLETNNVFDLPNCELCKLEEIADFITAVLASPI
RKERLALILENDDYIKNLLQLFHTCEDLGNTAGLHHLHTIIKGILFLNKTALFEIMFSAE
CIMDVVGCLEYDPALAQPKRHREFLTQHARLKEVVPITNGELRQKIHQTYKIQYIYDILL
PAPSMYEENFLSSLTTFIFLNKVEIVSMLQDENFLSEVFAQLKNAAIDDDRRRELLLFFK
EFCAFSQTLQPPKKDALFKTLTELGILPVLKIVMSMENLQIRSAATDIFTYLVEYSPSMI
REFIMEEAQESEDGNLFINLVIEQMICDTDPELGGAVHLMGLLRTLLDPENMHATSTKCE
RSEFLNFFYKHCIHNFIAPLVATTSEDICEGDSEVGSDENNTHCLNNYQTAQLLSLILEL
LTFCVQHHTYYIKNYILSKDLLRRVLILINSKHTFLVLSSLRFMRRMIGLKDELYNCYII
KGNLFEPVVKALLGNGTRYNMLNSAAIELFEYIRAENIKSLITHIVEKFYKALESIEYVQ
TFKGLKIKYEQEKDRQNQIRKNLHSILHSKILRRSTRVMDKKEEKCLKGNSEEGEATMPP
LEDNFQDRFKFMETKKPKENEDKVAPPKRSSSGGYKYTISHSAAAANGTRSLQGSSTVGL
MNPPDDDEKDKEDETSPRKRPHLSL
Download sequence
Identical sequences M3Z5H1
ENSMPUP00000018833 ENSMPUP00000018833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]