SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018840 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018840
Domain Number 1 Region: 86-148
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.84e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018840   Gene: ENSMPUG00000018960   Transcript: ENSMPUT00000019112
Sequence length 331
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897098.1:159839:160834:-1 gene:ENSMPUG00000018960 transcript:ENSMPUT00000019112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKPYVKSKEVTELVNTPSWMDKGLSSQNEMKEEERRPATYGMLGSLAEEHDSIEEEEEE
EEDGEKPKRRGPKKKKMTKARLERFRARRVKANARERTRMHGLNDALDNLRRVMPCYSKT
QKLSKIETLRLARNYIWALSEVLETGQTPEGKGFVEMLCKGLSQPTSNLVAGCLQLGPQS
VLLEKHEEKSPICDSAISVHNFNYQSPGLPSPPYGHMETHLINLKPPVFKSLGESSFGSH
PPDCSTPPYEGPLTPPLSISGNFSLKQDGSPDLDKSYSFMPHYPSASLNSGHVHSTPFQA
ATPRYDVPIDMSYDSYPHHGIGAQLNTIFTD
Download sequence
Identical sequences M3Z5H8
XP_004774572.1.14098 XP_004774573.1.14098 XP_004774574.1.14098 ENSMPUP00000018840 ENSMPUP00000018840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]