SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018841 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018841
Domain Number 1 Region: 14-245
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.29e-30
Family RNA-dependent RNA-polymerase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018841   Gene: ENSMPUG00000018961   Transcript: ENSMPUT00000019113
Sequence length 322
Comment pep:novel scaffold:MusPutFur1.0:GL896919.1:1490859:1492023:1 gene:ENSMPUG00000018961 transcript:ENSMPUT00000019113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGKLPNSFYEASITLIPKPDKDPTRKESYRPISLMNTDAKILNKILANRIQQYIKKIIH
HDQVGFIPGLQGWFNIRKSVNVIQHINKRKNKNHMILSIDAEKAFDKVQHPFLIKTLQSV
GIEGTYLNIIKAIYKKPTANIILNGEKLKAFPLRSGTRQGCPLSPLLFNIVLEVLASESR
QQKEIKGIQIGKEEVKLSLFADDMILYVENPKDSTPKLLELIQEFSKVSGYKINAQKSVA
FLYTNSKTEERDIKESIPFTIAAKTIRYLGINLTKETQNLYSENYKVLMKEIEEDTKKWK
NVPCSWIGRINIVKMSMLPKAI
Download sequence
Identical sequences M3Z5H9
ENSMPUP00000018841 ENSMPUP00000018841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]