SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018958 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018958
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.13e-24
Family THAP domain 0.0000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018958   Gene: ENSMPUG00000019081   Transcript: ENSMPUT00000019233
Sequence length 218
Comment pep:novel scaffold:MusPutFur1.0:GL896962.1:7476904:7477560:-1 gene:ENSMPUG00000019081 transcript:ENSMPUT00000019233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTNCAAAGCATTYNKHINISFHRFPLDPKRRKEWIRLLRRKNFVPGKHTFLCSKHFEAS
CFDLTGQTRRLKMDAVPTIFDFCTHLKSMKLKSRNLLKKNNSCTPTGASNLKSNISSQQV
LLEHSYAFRNPMEAKKRIIKLEKEIASLRKKMKTCLQKERRATRRWIKATCLVKNLEANN
ILPKGTSEHILPTALSSLPLEDFKILEPDQQDKTLPIL
Download sequence
Identical sequences M3Z5U6
ENSMPUP00000018958 ENSMPUP00000018958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]