SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019055 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019055
Domain Number 1 Region: 110-172
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.98e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019055   Gene: ENSMPUG00000019178   Transcript: ENSMPUT00000019330
Sequence length 272
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896920.1:4863288:4864106:1 gene:ENSMPUG00000019178 transcript:ENSMPUT00000019330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVKSETLELKEEEDVLVLLGSASPASAALTPLSSSADEEEEEELGASGRARRPRGAEVG
SGGLGGSPARAEGCRPARLLGLVHECKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNR
ERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGGG
LPGALFSETVLLSPGGASASLSSSGDSPSPASTWSCTNSPAPSSSASSNSTSPYSCTLSP
ASPAGSDMDYWQPPPPEKHRYAPHLPIVRDCI
Download sequence
Identical sequences M3Z642
XP_004748110.1.14098 ENSMPUP00000019055 ENSMPUP00000019055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]