SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019260 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019260
Domain Number 1 Region: 77-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.79e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019260   Gene: ENSMPUG00000019387   Transcript: ENSMPUT00000019539
Sequence length 135
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897059.1:4203313:4203720:1 gene:ENSMPUG00000019387 transcript:ENSMPUT00000019539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLSPDQAADSDHPSSAHSDPESLGGADAKVLGSVSDLEPVEEAEGDGKGGSRAALYPHP
QQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILR
LAICYISYLNHVLDV
Download sequence
Identical sequences A0A2K5C2A3 A0A2K5PHN2 H0VXK0 L5K655 M3Z6P7 U3E8V5
ENSCPOP00000015430 ENSPVAP00000011965 10141.ENSCPOP00000015430 XP_003479310.1.53824 XP_004416569.1.74151 XP_004689663.1.23501 XP_006744891.1.47382 XP_006895734.1.29581 XP_006919735.1.64745 XP_011364873.1.92234 XP_012314302.1.9421 XP_012617419.1.48125 XP_012617420.1.48125 XP_012900491.1.14098 XP_017379692.1.71028 XP_020042069.1.5219 XP_021545911.1.83697 ENSPVAP00000011965 ENSMICP00000002594 ENSMPUP00000019260 ENSMICP00000002594 ENSCPOP00000015430 ENSMPUP00000019260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]