SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019345 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019345
Domain Number 1 Region: 75-132
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.96e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019345   Gene: ENSMPUG00000019473   Transcript: ENSMPUT00000019625
Sequence length 133
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897121.1:2090881:2091282:1 gene:ENSMPUG00000019473 transcript:ENSMPUT00000019625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLNSDTVELDLPPSHSETESGFSDCGGGAGPDGAGPGVPGGGQARGLEPGEPCRKDLQH
LSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLA
ICYISYLNHVLDV
Download sequence
Identical sequences M3Z6Y2
ENSMPUP00000019345 ENSMPUP00000019345 XP_004775911.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]