SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019356 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019356
Domain Number 1 Region: 116-183
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000628
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019356   Gene: ENSMPUG00000019484   Transcript: ENSMPUT00000019636
Sequence length 193
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896914.1:12795563:12796144:1 gene:ENSMPUG00000019484 transcript:ENSMPUT00000019636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNLRETFLSLEEGLGPSDSPGLLSSWDWNNRAGPFEVNQASPTQSLSPASSLGSYSSSP
RPAVAELACGHGGATSGGSGGCDGRGTGGLVEVDYNMLAFQPAYLQGAGGPKAQKGAKVR
MSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIRELTD
LLNGGREPRPQSA
Download sequence
Identical sequences M3Z6Z3
ENSMPUP00000019356 XP_004745893.1.14098 ENSMPUP00000019356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]