SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019464 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019464
Domain Number 1 Region: 14-133
Classification Level Classification E-value
Superfamily PH domain-like 2.14e-17
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019464   Gene: ENSMPUG00000019592   Transcript: ENSMPUT00000019744
Sequence length 257
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897060.1:3287263:3288036:-1 gene:ENSMPUG00000019592 transcript:ENSMPUT00000019744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLNERSVAHYALSDSPADHTGFLRTWGGPGTAPTPSGTGRRCWFVLKGNLLFSFESRES
RAPLSLVVLEGCTVELAEAPVSEEFAFAICFDAPGVRPHLLAADGPAAQEAWVKALSRAS
FSYMRLVVRELESQLREARHSLALHRHSSWKAIGSHCKPQAPDRRSPGLENGHSPSKDCS
PVDSVEERGSKLARQGLAEWQGPASLFLDRRQSPAFPETSYFSTLHNWYGQEITELRQRW
LRRVWGSQPAREKQDGP
Download sequence
Identical sequences M3Z7A1
ENSMPUP00000019464 ENSMPUP00000019464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]