SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019493 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019493
Domain Number 1 Region: 330-554
Classification Level Classification E-value
Superfamily Cullin repeat-like 1.31e-60
Family Exocyst complex component 0.0012
Further Details:      
 
Domain Number 2 Region: 180-287
Classification Level Classification E-value
Superfamily PH domain-like 1.98e-28
Family Pleckstrin-homology domain (PH domain) 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019493   Gene: ENSMPUG00000019621   Transcript: ENSMPUT00000019773
Sequence length 725
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897124.1:841223:843400:-1 gene:ENSMPUG00000019621 transcript:ENSMPUT00000019773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMAMSDSGATRLRRQLESGGFEARLYVKQLSQQSDGDRDLQEHRQRIQALAEETAQNLK
RNVYQNYRQFIETAREISYLESEMYQLSHLLTEQKSSLESIPLTLLPAAAAAGAAAASGG
EEGGGGAGGRDHLRGQAGFFPTPGGASRDSSGPGEEGKQRTLTTLLEKVEGCRHLLETPG
QYLVYNGDLVEYEADHMAQLQRVHGFLMNDCLLVATWLPQRRGMYRYNALYPLDGLAVVN
VKDNPPMKDMFKLLMFPESRIFQAENAKIKREWLEVLEETKRALSEKRRREQEEAAAPRA
PPQVTSKASNPFEDEEDDEPAVPEVEEEKVDLSMEWIQELPEDLDVCIAQRDFEGAVDLL
DKLNHYLEDKPSPPPVKELRAKVDERVRQLTEVLVFELSPDRSLRGGPKATRRAVSQLIR
LGQCTKACELFLRNRAAAVHTAIRQLRIEGATLLYIHKLCHVFFTSLLETAREFETDFAG
TDSGCYSAFVVWARSAMGMFVDAFSKQVFDSKESLSTAAECVKVAKEHCQQLGDIGLDLT
FIIHALLVKDIQGALHNYKEIIIEATKHRNSEEMWRRMNLMTPEALGKLKEEMKSCGVRN
FEQYTGDDCWVNLSYTVVAFTKQTMGFLEEALKLYFPELHMVLLESLVEIILVAVQHVDY
SLRCEQDPEKKAFIRQNASFLYETVLPVVEKRFEEGVGKPAKQLQDLRNASRLIRVNPES
TTSVV
Download sequence
Identical sequences M3Z7D0
XP_004776076.1.14098 ENSMPUP00000019493 ENSMPUP00000019493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]