SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019511 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019511
Domain Number 1 Region: 336-414
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.4e-24
Family Intermediate filament protein, coiled coil region 0.0011
Further Details:      
 
Domain Number 2 Region: 105-139
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000141
Family Intermediate filament protein, coiled coil region 0.0021
Further Details:      
 
Domain Number 3 Region: 218-332
Classification Level Classification E-value
Superfamily Prefoldin 0.0000288
Family Prefoldin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019511   Gene: ENSMPUG00000019639   Transcript: ENSMPUT00000019791
Sequence length 429
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896917.1:17211251:17212612:-1 gene:ENSMPUG00000019639 transcript:ENSMPUT00000019791 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTTFLQTSSSTFGGGSTRGGTLRVGGGGFGGGSLCGGGGSRTISASSARFVSSGSGGGY
GGGMSCGFGGGACSGFGGGLGGGFGGSFGGGFGDYGGGDGGLLSGNEKITMQNLNDRLAS
YLEKVRALEEANTELEVKIRDWYQKQSPSSPERDYSPYFKTIEELRDKILAATIDNNRVI
LEIDNARLAADDFRLKYENELALRQSVEADINGLRRVLDELTLAKADLEMQIEGLNEELA
YLKKNHEEEMKEYGSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDAEAWFF
SKTEELNKEVASNTEMIQTSKTEITDLRRTMQGLEIELQSQLSMKTGLEGSLAETECRYA
TQLQQIQGLISSLEAQLSELRNEMECQNQEYKTLLDIKSRLEQEIATYRSLLEGQDARXX
XXXXXXXXX
Download sequence
Identical sequences M3Z7E8
ENSMPUP00000019511 ENSMPUP00000019511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]