SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019719 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019719
Domain Number 1 Region: 54-126
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.18e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019719   Gene: ENSMPUG00000019849   Transcript: ENSMPUT00000020001
Sequence length 194
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896969.1:8282700:8283284:1 gene:ENSMPUG00000019849 transcript:ENSMPUT00000020001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSGALPGPAPSVPGVSGGCVPRRRPTSPELLRCSRRRRPGATESGGGAAAVARRNERER
NRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRAALAEGL
LAPAARPSASCGPPGTPAAALGSPSCASSSPGGGGSSEPGSPRSAYSSDDSGCEGALSPV
ARELLDFSSWLGGY
Download sequence
Identical sequences M3Z806
XP_004759716.1.14098 XP_004759717.1.14098 ENSMPUP00000019719 ENSMPUP00000019719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]