SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019744 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019744
Domain Number 1 Region: 846-919
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-18
Family SH3-domain 0.0000499
Further Details:      
 
Domain Number 2 Region: 1462-1543
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000131
Family SH3-domain 0.0016
Further Details:      
 
Domain Number 3 Region: 1578-1655
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000761
Family SH3-domain 0.0015
Further Details:      
 
Domain Number 4 Region: 1015-1150
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000231
Family Fibronectin type III 0.00098
Further Details:      
 
Domain Number 5 Region: 336-344
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000863
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019744   Gene: ENSMPUG00000019874   Transcript: ENSMPUT00000020026
Sequence length 1660
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896906.1:1926866:1933742:1 gene:ENSMPUG00000019874 transcript:ENSMPUT00000020026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKDSPSPSGGGRATPKKPGSPGPSAVVLEEQRRELEKLRAELETERARGRAERQRFASQ
ARQLREAAERERQQLVDHLRSKWEAQRGRELRQLQEEVLREREAEIRQLLRWKEAEMRQL
RQLLHRERDGVMRQARELQRQLAEELVNRGYCGRAGAPEVAAAQCRCRLQEVLAQLRWET
DGEQASRIRHLQAALDVERQLFLKYILEHFRWHPALPGSPDPQAVHSSEGPPGDTVADSD
GPPKIMCRLESLNADSLTGGVRLRSRSLDVVRAGRSNSSNSLLHTRASSLDSLPPARSRS
LDSTLGCPKAPESEERASSPDASVLGSPSAPAPPPPPPPPPPPPPPPSEHRRPSDPPEDP
GSQPCEALTPSSPGLDYQELVKQNSELSKALRAVARRCSGLREENTQLRRAGFQDKSDEK
VKRLKVKHAKLTGLARRLEDRARKLQETNLRAVSAPVPGDSRASLELCQAFSRQRARDLS
EQASALLAKDKQIEELRQECHLLQARVASGFGSVLHPGRGAAQAQVQAQWLDISELDRLQ
RESQREVLRLQRQLTRQQASGSARVEADGQGAPSEEARRQVQALELELGARRRECEELSA
QAAAAQRRGDEAEAQLQAALREGAWLTQENARLQAQADWTQKVAAENDDVRGQLDRACQE
RDAASMLAEQLLQQAARGQDRQQQLQHDLRKALHDLQAAREEMLALQCQPGHPPPEPQEA
PQVPESQVRDPGRTKFQPDPPDQASSEPSRDKRENQEASRPGSPVAIREPASAPQMPDRV
LASPPLDSRYQAKKTSSQSNSSSEVESAWATVPSCPTLDMDTASEMEDLEPDSMSSTLEV
GGSEARLPPKLKIFLARYSYNPFKGPNEHPESELPLTAGDYVYIFGDMDEDGFYEGELED
GRRGLVPSNLVEQIPDSDILDCLPLKSPDFGPTRLPPGQSKGLTEDTGHSFLPGKAQGAM
DKGPCLMVGVAPKTEGAAEITDAKTEDSWLGALQCMKEKGFSRPLLGATGALCMAPMQLH
LQSVAATSAKIAWVYGSSSHLHMVYLNGQEHALTPAGVSSYTFHGLLPGTRYRAWVEVRL
PWDSLQVHWKTSSSTITFKTPLAGPPDPPLDVLVERHASPGLLMVSWLPVTIDSAGSSNG
VQVTGYAIYADGLKVAEVTDATAGSTLLEYSQLQQPLLCQSVSVRTMSLCGESLDSVPAQ
IPHDCFTCHQLPETSSFSHPCGDPSTCRVTVPVCSQRLTLSPLSATVSPHAPGSCGESQA
EFLEAFSEEPLRRQSPMPNLDPEKECASAGCSRQAQGPPETQEVCRKDLLFQQSSPNHRP
PLPIGQSRGEDRYCHMGPRQSPASGVIHPFPERGLNKEIYQEKSALEKVLRQKQDTQVIV
PLRLDASQPYVSDFHDIQDVMQEEAAMCFSPWGTRRREQRREFRTQNGRGQALGGKRMCQ
LREPSPALCPAPSSKVMKMPRGGPSPLGTGGDTLVRVFVALFDYNPLVMSANPEVAEEEL
AFQKGQLLRVWGSQDPCGFYHGECNGQVGTIPGHLVAEVKVGTEQTDGKWHLPVQGYLPP
MAPFDDFGGLTSPQSSFPMPQGNPRMSSLWTPTTMMAALDYDPKDGRAGGQVKDKLSLRA
GDVVTVYGPVDDKGFYYGESGGHRGLVPAHLLDHLTLHGE
Download sequence
Identical sequences M3Z831
XP_004742596.1.14098 ENSMPUP00000019744 ENSMPUP00000019744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]