SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019765 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019765
Domain Number 1 Region: 4-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.41e-16
Family THAP domain 0.0023
Further Details:      
 
Domain Number 2 Region: 99-249
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0000863
Family Outer membrane efflux proteins (OEP) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019765   Gene: ENSMPUG00000019895   Transcript: ENSMPUT00000020047
Sequence length 313
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896910.1:18700421:18701362:1 gene:ENSMPUG00000019895 transcript:ENSMPUT00000020047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRL
CSVHFQGGRKTYTVRVPTIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQASPSASTAQASQLQPNLVSASAAVLLTLQAAVDSSQAPGSVPPAPTTPT
GEDVKPIDLTVQVEFAAAEGAAAAAAASELEAATAGLEAAECPMGPQLVVVGEEGFPDTG
SDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEAKLREELREKDR
LLAMAVIRKKHGM
Download sequence
Identical sequences M3Z852
ENSMPUP00000019765 XP_004744509.1.14098 ENSMPUP00000019765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]