SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019783 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019783
Domain Number 1 Region: 32-129
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-23
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 176-223
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000536
Family SOCS box-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019783   Gene: ENSMPUG00000019914   Transcript: ENSMPUT00000020066
Sequence length 225
Comment pep:known scaffold:MusPutFur1.0:GL896922.1:3447665:3448342:1 gene:ENSMPUG00000019914 transcript:ENSMPUT00000020066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPPSQPLPGNPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Download sequence
Identical sequences G9KQK6 U6CX24
XP_004416299.1.74151 XP_004748856.1.14098 XP_006734332.1.47382 XP_021536491.1.83697 ENSMPUP00000019783 ENSMPUP00000019783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]