SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019856 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019856
Domain Number 1 Region: 302-417
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.26e-17
Family Synaptotagmin-like (S variant) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019856   Gene: ENSMPUG00000019987   Transcript: ENSMPUT00000020139
Sequence length 420
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897163.1:1870801:1872063:1 gene:ENSMPUG00000019987 transcript:ENSMPUT00000020139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKTNLWFLERLRGSGENVPPGSEAGDKTSKGPLYSNVLTPDKIPDFFIPPKLPAGPTEP
EGPAELGPTSSEQSLASGTPRRAPRSPRLPAKLAAESKSLLKAATRHVIQIESAEDWPPE
EAATNADPQAQGAMSLPSVPKAQTSYGFATLAESPHTRRKESLFHSEHGALAQMGSPGAG
RRRGGAKANGGDGVPREAGGALMSPSRYFSGGESDTGSSAESSPFGSPLLSRSVSLLRGF
AQDSQAKVSQLKHSAGRPGSLSAEDSAPDTSPRARRRLARRPTPEPGPEPGQAPRAEHAV
PMGPRGSVRLLAEYEAAQARLRVRLLAAEGLYDHLCDARSINCCVGLCLVPGKLQKQRST
IIKNSHHPVFNEDFFFDGLGPASVRKLALRVKVVNKGGSLKRDALLGEKELPLTSLLPFL
Download sequence
Identical sequences M3Z8E2
XP_004778201.1.14098 ENSMPUP00000019856 ENSMPUP00000019856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]