SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019952 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019952
Domain Number 1 Region: 117-179
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.58e-18
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000019952
Domain Number - Region: 37-45
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0602
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019952   Gene: ENSMPUG00000020084   Transcript: ENSMPUT00000020236
Sequence length 381
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897006.1:1252514:1253659:1 gene:ENSMPUG00000020084 transcript:ENSMPUT00000020236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTRLFSEPGLLSDVPKFASWGDGDDDEPRSDKGDAPPPPPPPGPGAPGPARAAKPVPLR
ADEVPEAALAEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRKMTKARLERSKL
RRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGK
RPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQGADGTGRFHGSGGPFAMHPYPY
PCSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLSP
PLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLSY
DMHLHHDRGPMYEELNAFFHN
Download sequence
Identical sequences M3Z8N8
ENSMPUP00000019952 ENSMPUP00000019952 XP_004764717.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]