SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019968 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019968
Domain Number 1 Region: 73-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.19e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019968   Gene: ENSMPUG00000020102   Transcript: ENSMPUT00000020254
Sequence length 187
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897102.1:1244314:1244877:-1 gene:ENSMPUG00000020102 transcript:ENSMPUT00000020254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTKNRPPRRRVPSQDTEATAGERSPDRAQQGSGPELAKGLRSRTARAQGARAEAGRRRP
GPSGAGGRRENSIQRRLESNERERQRMHKLNNAFQALREVIPHVRADKKLSKIETLTLAK
NYIKSLTSTILTMSSGRLPGLDGPGPKLYQHYQQQQAAGGTLGATEPQPEGHLHRYSTQI
HSFREGS
Download sequence
Identical sequences M3Z8Q4
XP_004775016.1.14098 ENSMPUP00000019968 ENSMPUP00000019968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]