SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019978 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019978
Domain Number 1 Region: 242-402
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 4.13e-63
Family Coatomer appendage domain 0.0000000316
Further Details:      
 
Domain Number 2 Region: 403-513
Classification Level Classification E-value
Superfamily Subdomain of clathrin and coatomer appendage domain 6.28e-34
Family Coatomer appendage domain 0.00000111
Further Details:      
 
Domain Number 3 Region: 2-186
Classification Level Classification E-value
Superfamily ARM repeat 3.17e-33
Family Clathrin adaptor core protein 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019978   Gene: ENSMPUG00000020112   Transcript: ENSMPUT00000020264
Sequence length 514
Comment pep:novel scaffold:MusPutFur1.0:GL896899.1:29956782:29958977:-1 gene:ENSMPUG00000020112 transcript:ENSMPUT00000020264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEYKRAIVDC
IISIIEENTESKETGLSHLCEFIEDCEFTVLATPILHLLGQEGPKTNNPSKYIRFIYNRV
VLEHEEVRAGAVSALAKFGAQNEEMLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQK
ALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPLATTPMAEQRTESTPITATN
QPEKVAATRQEIFQEQLAAVPEFQGLGPLFKSSPEPVALTESETEYVIRCTKHTFTDHMV
FQFDCTNTLNDQTLENVTVQMEPTEAYEVLCYVPARSLPYNQPGTCYTLVALPKEDPRAV
ACTFSCMMKFTVKDCDPTTGETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVG
DEFEKEETFTLSTIKTLEEAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDI
LVRSRLLLLDTVTMQVTARSSEELPVDILLASVG
Download sequence
Identical sequences M3Z8R4
ENSMPUP00000019978 ENSMPUP00000019978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]