SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000200 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000200
Domain Number 1 Region: 34-182
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.75e-42
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 157-342
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-35
Family Laminin G-like module 0.0076
Further Details:      
 
Domain Number 3 Region: 728-744,779-942
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-35
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 342-526
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-32
Family Laminin G-like module 0.0045
Further Details:      
 
Domain Number 5 Region: 973-1178
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-28
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 6 Region: 583-641
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000115
Family Fibrinogen C-terminal domain-like 0.0036
Further Details:      
 
Domain Number 7 Region: 555-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000662
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000200   Gene: ENSMPUG00000000203   Transcript: ENSMPUT00000000204
Sequence length 1311
Comment pep:novel scaffold:MusPutFur1.0:GL896909.1:4026605:4132682:-1 gene:ENSMPUG00000000203 transcript:ENSMPUT00000000204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECAPWEPLTFSLDSCLLSGLQSVLTCVFSPTDGCDQPLASALPASSFSGSSELSSSHGPG
FARLNRRDEGAGGWTPRVSNRSQWLQIDLGDRMVVTAVATQGGYGSSSWVTSYLLMFSDS
GRNWKLYRREESIAGFPGNANADSVVRHRLRPPLEARHLRFLPSAWNPDGRIGMRVEVYG
CRFRSDVMDFDGKSSLLYRFVQSTRNPVKDIISLKFKTRQSDGLLLHRRGRNGDFFTLEL
VKGRLLLITNSGTASPSPSGPGSVALGSLLDDQHWHSVLLEHARQHMTLSVDRHSRQFQA
WGQLSHADLDPEISFGGILAPGKSVTFQRKHFDGCLENINFNGEDIIDLAKKHRPQILIR
GNASFSCSQPQSVLVTFPTAGSRLVLPGSPAQDGVSISFQFRTWNQAGLLLSRQHPRGST
GFVLTLRDGALRLGLSPSPGHVKSDIMAGAGLNDGQWHSVSLTARRNQLSVVVDQVGVSA
VHTALPLETHADGSYHFGGCLSSGSGSDCEASLAGFQGCLRLISINAQEVDLISVQRGVL
GNFSSLDIDSCGIRDRCLPNRCEHGGRCSQTWTAFHCNCSGTGYTGATCRQPLYEQSCEA
YKHRGESLGRYYVDPDGSGPLQPFPVFCNMTDVPWTVVQHNSSALTRVKGADQNNPHWAV
FQYEASLEQLRAIIASARHCQQMLEFHCRRSRLRDPQDGTPLSWWVGSTHGTRTYWAGSM
PEAQTCACGLAGNCVDSQHLCNCDADQDEWTNDTGVLSYKEHLPVTRIVVADAARPSSAA
AYRLGPLLCQGDRSFWNSASFHTETSYLHFPTLHAELSADVSFFFKTRASSGVFLENLGI
TDFISLELRSPREVAFSFDVGNGPCEVTVRAPGPLNDDRWHLVRAERNIKEAWLQVDLLP
PGTHTAPEDGHMRLQLNSQLFVGGTATRQRGFLGCIRSLQLNGKVLDLEERAQVTPGVQP
GCPGHCSTYGHLCHNGGRCQERSRGFSCDCELSAFSGPFCTQEVSAHFGAGSSVTYNFHE
FYPLSTNSSPHAASFHGDMTLARERITFSFQTLQTPSLLLYVDSFYNKYLSVILAKNGSL
QIRYKLGLHEDPDVFNFNFKNMADGHLHHVKINREEGVIFVEVDQKARSQVSLSSGMEFN
AVKSLVLGKILEPSDHVDEDTARAGARGFSGCLSALQFQRTAPLKAALHPGRSGRTSVLG
PVASSECGARPGVGRVREHKHPRAEHPGAAEQGKPVETGNRRRSALIGGVVAMAIFVLLC
MAAVAVHLYQQRSLRATTEVEGPRKQGSNAAAPRCELGRPDTMGGDQQAGL
Download sequence
Identical sequences M3XMA0
ENSMPUP00000000200 ENSMPUP00000000200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]