SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000227 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000227
Domain Number 1 Region: 235-479
Classification Level Classification E-value
Superfamily Caspase-like 2.24e-56
Family Caspase catalytic domain 0.00023
Further Details:      
 
Domain Number 2 Region: 90-191
Classification Level Classification E-value
Superfamily DEATH domain 5.06e-23
Family DEATH effector domain, DED 0.0064
Further Details:      
 
Domain Number 3 Region: 5-74
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000165
Family DEATH effector domain, DED 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000227   Gene: ENSMPUG00000000230   Transcript: ENSMPUT00000000231
Sequence length 482
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897001.1:407179:439297:1 gene:ENSMPUG00000000230 transcript:ENSMPUT00000000231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTEVIHQVEEALDEDEKKVLLFLCRDVAADVAPLNVRDLLDILSERGVLSAMGLAELLY
RVRRFDLLKRIFKMDRRAVEAHLLRHPGLISDYRVLMTEIGGNLENSDLSSLFFLMRDYL
GRRKVAKDKSFLDLVIELEKLNLIAPDQLDLLEKCLKNIHRVDLKTKIQKYKQSAQGPET
SYTNALQASFRNLSLKDPSCNLRLQNGRTKEQRLNVGQLDLQRESVKASIQESEAFLPRH
VPEERYRMQSKPLGICLIIDCIGNDAAFLRDTFTSLGYEVQSFLYLSVDGIIQVLRRVAC
MPQHRDYDSFVCVLVSRGGSHSVFGVDRTHSGFPLDQIRRMFMGDACPFLLGKPKVFFIQ
NYVDSEDPLDNSSLLEVDGPAVNNLESKAKQPGSSTLHREADFLWSLCKADVSLLERSSS
SPSLYLQCLSQKLGKERRRPLLELHIELNGSVYDWNSRASTKERYSVWLQHTLRKKLILS
WE
Download sequence
Identical sequences M3XMC7
ENSMPUP00000000227 ENSMPUP00000000227 XP_004764213.1.14098 XP_004764215.1.14098 XP_004764217.1.14098 XP_004764218.1.14098 XP_004764219.1.14098 XP_012917726.1.14098 XP_012917727.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]