SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000259 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000259
Domain Number 1 Region: 20-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000214
Family PARP-type zinc finger 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000259   Gene: ENSMPUG00000000262   Transcript: ENSMPUT00000000263
Sequence length 105
Comment pep:novel scaffold:MusPutFur1.0:GL896978.1:1015951:1017296:-1 gene:ENSMPUG00000000262 transcript:ENSMPUT00000000263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLPCFLARSQVEFCSGSFEIAKRGMASCKKRSRGDMREWYHIKCTFEKLKWAQATTKD
IEDHIELESWEELEDNEKAQIIQHIADLSSKKCPNSLFSEIKYSG
Download sequence
Identical sequences M3XMF9
ENSMPUP00000000259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]