SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000311 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000311
Domain Number 1 Region: 140-228
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-22
Family PDZ domain 0.000099
Further Details:      
 
Domain Number 2 Region: 21-57
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000945
Family PDZ domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000311   Gene: ENSMPUG00000000313   Transcript: ENSMPUT00000000315
Sequence length 778
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897011.1:786418:919946:1 gene:ENSMPUG00000000313 transcript:ENSMPUT00000000315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCNLCTFQKREEHYKLLYEVSQVNGKDLSKATHEEAVEAFRNAKEPIVVQVLRRTPLSK
PAYGTAPAVQLMDASTQTDITFEHIMALAKLRPPTPPVPDICPFLLSDSCHSLHPMEHEF
YEDNEYLSSLPADADRAEDFEYEEVELCRVSSQEKLGLTVCYRTDDEEDTGIYVSEVDPN
SIAAKDGRIREGDRILQINGEDVQNREEAVALLSSDECKRIVLLVARPEIQLDEGWLEDE
RNEFLEELNLEMLEEQHNEAMQGTANEVEQPKKQEEEEGTTDTATSSSNNHEKDSGVGRT
DESLRNDESSEQENAAEDPNSTSLKSTRELGQSQDTLGSVELQCNESFVSGEYIDSDCLG
NPDEECERFRQLLELKCKIRNHGEYDLYYSSSTIECHQGEQEGVEHELQLLNEELRNIEL
ECQNIMQAHRLQKATDPYGDIWALHDGGFRNYNTSMDMPRGKLDDIIEHPEKSDKDSSSA
YNTAESCRSTPLTVDRSPDSSLPRMINLTNKKNLRSTMAASPSSSGQSSKESTSTKAKTI
EAGCSAEGQEKISEGSKVSEQEKPSSEHIPYLSPYHSSSYRYANIPAHARHYQSYMQLIQ
QKSAVEYAQSQLSLVSVCKEAQKCSEPKMEWKVKIRSDGTRYITKRPVRDRILRERALKI
KEERSGMTTDDDTMSEMKMGRYWSKEERKQHLVRAKEQRRRREFMMRSRLECLKESPQSG
SEGKKEINILELSHKKMMKKRNKKILDNWMTIQELMTHGAKSPDGTRVHNAFLSVTTV
Download sequence
Identical sequences M3XML1
XP_004765601.1.14098 ENSMPUP00000000311 ENSMPUP00000000311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]