SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000650 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000650
Domain Number 1 Region: 491-656
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 3.4e-70
Family A middle domain of Talin 1 0.0000003
Further Details:      
 
Domain Number 2 Region: 756-891
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.94e-53
Family I/LWEQ domain 0.00000202
Further Details:      
 
Domain Number 3 Region: 661-785
Classification Level Classification E-value
Superfamily I/LWEQ domain 5.1e-52
Family I/LWEQ domain 0.00000457
Further Details:      
 
Domain Number 4 Region: 2296-2486
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.08e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 5 Region: 1840-1974
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.49e-47
Family VBS domain 0.00000732
Further Details:      
 
Domain Number 6 Region: 1227-1363
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.49e-41
Family VBS domain 0.028
Further Details:      
 
Domain Number 7 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 8.37e-32
Family Second domain of FERM 0.0000013
Further Details:      
 
Domain Number 8 Region: 1076-1209
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 6.75e-29
Family VBS domain 0.012
Further Details:      
 
Domain Number 9 Region: 312-402
Classification Level Classification E-value
Superfamily PH domain-like 8.88e-25
Family Third domain of FERM 0.0000172
Further Details:      
 
Domain Number 10 Region: 1471-1557
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000118
Family I/LWEQ domain 0.0092
Further Details:      
 
Domain Number 11 Region: 2006-2133
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000000683
Family VBS domain 0.014
Further Details:      
 
Domain Number 12 Region: 1698-1816
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000173
Family VBS domain 0.063
Further Details:      
 
Domain Number 13 Region: 81-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000777
Family Ubiquitin-related 0.062
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000000650
Domain Number - Region: 946-1044
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000141
Family I/LWEQ domain 0.0029
Further Details:      
 
Domain Number - Region: 1586-1661
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000377
Family VBS domain 0.039
Further Details:      
 
Domain Number - Region: 2108-2229
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0131
Family I/LWEQ domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000650   Gene: ENSMPUG00000000655   Transcript: ENSMPUT00000000662
Sequence length 2542
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896964.1:6690251:7042203:-1 gene:ENSMPUG00000000655 transcript:ENSMPUT00000000662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRAGKVEHGSVALPAVMRSGSSGPETFNMGSMPSPQQQVVV
GQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAAL
MDDEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGE
NETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLV
ACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATDDSELLKQVSAAASVVSQA
LHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKA
VADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAM
QLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALSTVQTLKSELQDAKMAAVESQLKP
LPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGV
AASTSDPAAAYAMLDSARDVMEGSAMLIQEAKQALIAPGDAESQQRLAQVAKAVSHSLNN
CVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVH
ATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLA
AKSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELETVKGMLD
NPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTE
AAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQVLSAATIV
AKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKC
RIATAPLIEAVENLTAFASNPEFVSIPAQISSEGSQAQEPILVSAKTMLESSSFLIRTAR
SLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQA
SLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYF
EPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEA
AQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVK
YSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGHLALQGQMAAATAEPEEIGFQIRTR
VQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACI
TAATAVSGIIADLDTTIMFATAGTLNAENNETFADHRENILKTAKALVEDTKLLVSGAAS
TPEKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLIGATK
GAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEYMKQELTV
FQSKEIPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTAC
KQASFHPDVSEEVRTRALRYGTECTLGYLDLLEHVLVILQKPSPELKHQLAAFSKRVAGA
VTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETL
DFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARM
VAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAA
GNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARK
KLAQIRQQQYKFLPTELREDEG
Download sequence
Identical sequences M3XNK0
ENSMPUP00000000650 XP_004758833.1.14098 ENSMPUP00000000650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]