SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000722 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000722
Domain Number 1 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 461-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-24
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 51-110
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.07e-21
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 503-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.2e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 255-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 8 Region: 211-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000121
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000722   Gene: ENSMPUG00000000725   Transcript: ENSMPUT00000000736
Sequence length 563
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896966.1:1729320:1750131:-1 gene:ENSMPUG00000000725 transcript:ENSMPUT00000000736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRHLPPMVQGTPPLLASQPRVSKQGTSCDQRGQGHIVQNNCSCGNRVRVLEESVTFKD
VVVLFTRDEWAQLSPTQRALYRDVMLENYSNLVSLGLLGPQSDVFSRLGKGEEWMLEDTS
GSFCLDWMTMPVSKNSPPKPDIPDQDLDQWMIKEGFTRDNHWKYDCQLEWQHGGQGVLAH
QKTPSVLHAQARDEPGKHCTVSSSFDQSQEFQSSKKAFECSECGKVFTKSSTLNKHQKVH
TEKLNANRKTVIKEKRYECRECGKAFHQSTHLIHHQRIHTGEKPYECKECGKAFSVSSSL
TYHQKIHTGEKPFECNLCGKAFIRNIHLAHHHRIHTGEKPFKCNICDKAFVCRAHLTKHQ
NIHSGEKPYKCNECGKAFNQSTSFLQHQRIHTGEKPFECNECGKAFRVNSSLTEHQRIHT
GEKPYKCSECGKAFRDNSSFARHRKIHTGEKPYRCGLCEKAFRDQSALAQHQRIHTGEKP
YTCNICEKAFSDHSALTQHKRIHTREKPYKCKICGKAFIRSTHLTQHQRIHTGEKPYKCN
KCGKAFNQTANLIQHQRHHIGEK
Download sequence
Identical sequences M3XNS2
ENSMPUP00000000722 ENSMPUP00000000722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]