SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001051 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001051
Domain Number 1 Region: 38-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.19e-40
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00065
Further Details:      
 
Domain Number 2 Region: 150-336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.85e-38
Family Laminin G-like module 0.0062
Further Details:      
 
Domain Number 3 Region: 335-520
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-37
Family Laminin G-like module 0.0066
Further Details:      
 
Domain Number 4 Region: 775-937
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-35
Family Laminin G-like module 0.0021
Further Details:      
 
Domain Number 5 Region: 968-1172
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.33e-31
Family Laminin G-like module 0.0075
Further Details:      
 
Domain Number 6 Region: 577-635
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000000147
Family Fibrinogen C-terminal domain-like 0.0053
Further Details:      
 
Domain Number 7 Region: 549-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000958
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001051   Gene: ENSMPUG00000001059   Transcript: ENSMPUT00000001072
Sequence length 1307
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896970.1:6758325:7588974:1 gene:ENSMPUG00000001059 transcript:ENSMPUT00000001072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVPRLTSVFTLLFSGLWHLGLTATNYNCDDPLASLLSPMAFSSSSDLTGTHSPAQLNR
RVGTGGWSPADSNAQQWLQMDLGNRVEITAVATQGRYGSSDWVTSYSLMFSDTGRNWKQY
KQEDSIWTFAGNMNADSVMHHKLLHSVRARFVRFVPLEWNPSGKIGMRVEVYGCSYKSDV
ADFDGRSSLLYRFNQKLMSTLKDVISLKFKSMQGDGVLFHGEGQRGDHITLELQKGRLAL
HLNLDDSKPRLSSSPPSATLGSLLDDQHWHSVLIERVGKQVNFSVDRHTQHFRTKGEADA
LDIDYELSFGGIPVPGKPGTFLKKNFHGCIENLYYNGINIIDLAKRRKHQIYTVGNVTFS
CSEPQIVPITFVNSRSSYLLLPGTPQIDGLSVSFQFRTWNKDGLLLSTELSEGSGTLLLS
LEGGTVRLVIQKMTERTAEILTGSNLNDGLWHSVSINARRDRITLSLDNDAASPAQDTTR
VQIYSGNSYYFGGCPDNLTDSQCLNPIKAFQGCMRLIFIDNQPKDLISVQQGSLGNFSDL
HIDLCSIKDRCLPNYCEHGGSCSQSWTTFYCNCSNTGYTGATCHNSLYEQSCEVYRHQGN
TAGFFYIDSDGSGPLGPLQVYCNITEDKIWTSVQHNNTELTHVRGADPEKPYTMALDYGG
SMEQLEAMIDSSEHCEQEVAYHCRRSRLLNTPDGTPFTWWIGRSNERHPYWGGAPPGVQQ
CECGLDESCLDIEHFCNCDADKDEWTNDTGFLSFKDHLPVTQIVITDTNRSNSEAAWRIG
PLRCYGDRHFWNAVSFYTEASYLHFPTFHAEFSADISFFFKTTALSGVFLENLGIKDFIR
LEISSPSEITFAIDVGNGPVELIVHSPSLLNDNQWHYVRAERNLKETSLQVDNLPKMTRE
TSEEGHFRLQLNSQLFVGGTSSRQKGFLGCIRSLHLNGQKLDLEERAKVTSGVRPGCPGH
CSTYGSICHNGGKCVEKYSGYFCDCTNSPYEGPFCKKEVSAVFEAGTSVMYMFQEPYPVT
KNISLSSSAIYADAAPSKENIAFSFVTAQAPSLLLYINSSSQDYLAVLLCKNGSLQVRYQ
LSKEETHVFNIDAENFANRRMHHLNINREGRELTIQVDQQLRLSYNFSPEVEFRAVRSLI
LGKVREHVGLDSVVAKANTLGFVGCLSSVQYNQVAPLKAALRHTTIAPVTVHGTLTESSC
GSMMDADVNAVTTVHSSSDPFGKTDEREPLTNAVRSDSAVIGGVIAVVIFIIFSIIGIMT
RFLYQHKQSHRTNQMKEKEYPENLDSSFRNDIDLQNTVSECKREYFI
Download sequence
Identical sequences M3XPQ1
XP_004759845.1.14098 ENSMPUP00000001051 ENSMPUP00000001051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]