SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001062 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001062
Domain Number 1 Region: 2-249
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.41e-40
Family Patatin 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001062   Gene: ENSMPUG00000001071   Transcript: ENSMPUT00000001084
Sequence length 253
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897031.1:1424396:1451381:1 gene:ENSMPUG00000001071 transcript:ENSMPUT00000001084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHINLSFAACGFLGIYHLGAASALCRHGQKLLKAVKAFAGASAGSLVASVLLTAPEKIE
ECNEFTYEFAEETRRQSFGAVTPGYDFMARLRSGMERILPSNAHELAHSRLHVSITNTKT
RENYLVSSFRSREDLIKVLLASSFVPIYAGLKPVEYRGQTWVDGGLTNSLPILPVGRTVT
ISPFSGRLDISPQDKGQLDLYVNLANQDVTLSVANLVRLNQALFPPCKRKMESLYQLGFD
DAIRFLLKENWFE
Download sequence
Identical sequences M3XPR2
XP_004768338.1.14098 XP_004768339.1.14098 XP_004768340.1.14098 XP_012919856.1.14098 ENSMPUP00000001062 ENSMPUP00000001062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]