SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001227 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001227
Domain Number 1 Region: 459-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.63e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 501-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 401-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.81e-18
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 5 Region: 305-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-17
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 6 Region: 57-120
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-16
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001227   Gene: ENSMPUG00000001237   Transcript: ENSMPUT00000001253
Sequence length 555
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897227.1:250454:259006:1 gene:ENSMPUG00000001237 transcript:ENSMPUT00000001253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSLESPGRPRQLPGTPDAELLQERAPPAPQHRASAPEGGRAAPPGAKSAGDRGRARPRD
SVTFEDVAVRFSGGEWRRLTRAQRRLYAAVMLDNYGLVVSLAQPGFAGPKPPLISCLERG
AEPRVRDLQDWGLLSCSFPGGQVLRRENMKCELHDQSRGPRETGVGSMIQRGFCKLQTLN
FILTVAADTAEACTSVWQCSTHRSFGTEVSEGGEVGGVLSGHPEAGGACVQDVKSENARD
PAGVETLGEEKGTLEERRARAVLANNLSADSKCTPRTRALTARSPRPGAARGHTFPLLHG
RVRAGEKPHACHECGKAFKTRKQLRVHRVTHTGEKPFRCAQCGKAFSSPSALCRHRKAHG
GERPHGCGACGKAFGSASRLRRHQRVHSGERPHECAVCGKAFRFRHCLTLHGRTHTGERP
YACGQCGRAFRGSSDLAKHGRIHSGEREKPFACPECGRAFRGKSNLTNHRRIHTGEKPYA
CEACGKAFHHRSGLTQHRRIHSGEKPYPCRECGAAFRQRAALVGHQRVHTGEKPYACEQC
GKAFRVSANLTGHKK
Download sequence
Identical sequences M3XQ77
ENSMPUP00000001227 ENSMPUP00000001227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]