SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001280 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001280
Domain Number 1 Region: 420-526
Classification Level Classification E-value
Superfamily Homeodomain-like 8.96e-37
Family SWIRM domain 0.0000739
Further Details:      
 
Domain Number 2 Region: 137-192,232-267
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000353
Family DNA topoisomerase II binding protein 1, TopBP1 0.076
Further Details:      
 
Domain Number 3 Region: 598-649
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000411
Family Homeodomain 0.07
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000001280
Domain Number - Region: 194-222
Classification Level Classification E-value
Superfamily Chromo domain-like 0.03
Family Chromo domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001280   Gene: ENSMPUG00000001291   Transcript: ENSMPUT00000001307
Sequence length 1120
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897076.1:687921:708116:-1 gene:ENSMPUG00000001291 transcript:ENSMPUT00000001307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQ
EEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRN
VEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYP
VPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEAAVEDAPTPEKPRKVHAK
WILDTDTFNEWMNEEDYEVNDDKSPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRK
RSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKT
VNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQ
THHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEY
LTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSG
LVPLQPKTPQQTSASQQMLNFPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATRE
WTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLA
YQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVE
EAAKVTGKADPAFGLESSGIAGTTSDEPERIEESGTDEARAEGQATEEKKEPKEPREGVG
AAEEETKEKTSEVPKKDEERGKQGDSEKESEKSDGDPIVDTEKEKEPKEGQEEVLKDVVE
SEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLE
IKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQ
PPPALPPGSQLVPPAGTGPPVVHSLAMAPASVAPAPAGGGAPPGSLGPSEQIGQAGSAAG
PQQQQPAGAPQPGAVPPGVPPPGPHGPSPFPNQQTPPAMMPGAVPGSGHPGVAAQSPAIV
AAVQGNLLPSASPLPDPGTPLPPDPTAPSPGTVTPVPPPQ
Download sequence
Identical sequences M3XQD0
ENSMPUP00000001280 ENSMPUP00000001280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]