SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001885 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001885
Domain Number 1 Region: 301-464
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.82e-51
Family SPRY domain 0.0000491
Further Details:      
 
Domain Number 2 Region: 16-89
Classification Level Classification E-value
Superfamily RING/U-box 6.03e-21
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 3 Region: 104-165
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000534
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001885   Gene: ENSMPUG00000001902   Transcript: ENSMPUT00000001923
Sequence length 485
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897113.1:3048472:3050568:1 gene:ENSMPUG00000001902 transcript:ENSMPUT00000001923 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKPTSVQVFIHSPMAVPAALAGLQAEANCPVCLDYLRDPVTTECGHNFCRCCIQQSWADL
KDRFPCPVCRHTCQERHLRSNTQLGRMIDIAKLLHITRTKKRRPEEKHLCEKHNQVLTLF
CEEDLEVLCPTCTQPPDHQGHLVRPMVEAASHHRQRLSRYIEPLKKQMENVQKLINIQSK
KPLELKEKVENQRQELLSEFECLKQFLDRDQEAVLLRLADEEKDIQQKLSANITAFSNYI
SVLRGLLSKVVENSVLSEVELLSQIKNFYRRSEDEISPSIFSIQLRREGCSFPPQYSALQ
KIINKFRVDIILDHETAHPNLIVSEDKKYVTFSKRKQNVPHFPKRFTANTVVLGFPYFYS
GRHYWEVEVGDKSEWAVGICKDSLPPKARRSSQAWQGCWVIQRQEDRYEVVGATATVLLL
AVNPRGIGIFLDYELGEISFYNRTEKSHIYTFTDTFTRPLSTQFEGVGGRHQREPLTYQC
LTAFP
Download sequence
Identical sequences M3XS35
ENSMPUP00000001885 ENSMPUP00000001885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]