SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001907 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001907
Domain Number 1 Region: 45-232
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-50
Family DBL homology domain (DH-domain) 0.0000119
Further Details:      
 
Domain Number 2 Region: 240-366
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-29
Family Pleckstrin-homology domain (PH domain) 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001907   Gene: ENSMPUG00000001923   Transcript: ENSMPUT00000001945
Sequence length 474
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897076.1:1885866:1889794:1 gene:ENSMPUG00000001923 transcript:ENSMPUT00000001945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEPALTTGEELPELTLLTTLLEGPGDKTQPPEEETLSQAPESEEEQKKKALERSMYVLS
ELVETEKMYVEDLGQIVEGYMATMAAQGVPESLRGRDRIVFGNVQQIYEWHRDYFLEELQ
RCLNDPDWLAQLFIKHERRLHMYVVYCQNKPKSEHVVSEFGDSYFEELRQQLGHRLQLSD
LLIKPVQRIMKYQLLLKDFLKYYSRAGMDTEELEQAVEVMCFVPKRCNDMMTLGRLRGFE
GKLTAQGKLLGQDTFWVTEPEAGGLLSSRGRERRVFLFEQIVIFSEALGGGVRGGSQAGY
VYKSSIKVSCLGLEGNLQGDPCRFALTSRGPEGGIQRYVLQSADPAVSQAWIKQVAQILE
SQRDFLNALQSPIEYQRRESQTNSLGRPGGLGVGSPGRIRPGDRAQVSTHTPINGSLPSL
RLLPKGEVARAPLPLDTQAHSDIPRAPHDSPPAPPIPDTPPCQARLAKLDEDEL
Download sequence
Identical sequences M3XS57
ENSMPUP00000001907 ENSMPUP00000001907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]